Иммунные исследования
Открытый доступ
ISSN: 1745-7580
ISSN: 1745-7580
Sahar Obi Abd Albagi, Safaa Hag Ahmed, Thana Eljozoli Mohamme, Esameldeen Ahmed Adam and Mohammed A Hassan
Background: Herpes simplex virus (HSV) is a common human pathogen, causing infections of orofacial mucosal surfaces (HSV-1) and genital mucosal surfaces (HSV-2). Productive infection results in the formation of vesicular lesions in the mucosal epithelia, followed by spread of the virus to sensory neurons and establishment of a latent infection that may remain for the life of the host.
Material and method: All sequences of glycoprotein E [Human herpes virus 3] were obtained from NCBI and these sequences were subjected to IEDB predicted tools, including B cell and T cell examination, with B cell having multiple tests such as epitopes prediction, surface accessibility and antigenicity prediction; T cell included MHC I and MHC II predicted tools. Finally we used population coverage to select a highest percent of peptides related with different alleles.
Result: We obtained some candidate peptides as vaccine derived peptides from B cell test which had a highest score in Emini surface accessibility (“DEDKLDTNSVYEPYYHSDHAESSWVNRGESSRKAYDHNSPYIWPRNDYDGF”) of 21.807, and “LKFVDTPESL" with score 1.061 for Kolaskar and Tongaonkar antigenicity test, in another hand we got a highest affinity of peptides that interacted with major coverage of different alleles in MHC I (“KAYDHNSPY”) and in MHC II (“MWNYHSHVF”).
Conclusion: The efficiency and safety degree in predicted candidate epitopes by computational examination methods are required to be estimated through studies of animal model, to check whether they are able to induce a good defending immune response or not with previous mentioned properties, and we considered this study as first promising peptide based vaccine of [Human herpes virus 3] glycoprotein E in comparison to the previous studies.